PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G041900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 317aa    MW: 33927.5 Da    PI: 8.0799
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G041900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.7e-1762107147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         rg W + Ed +l+++v+q+G+ +W++Ia+++  gR++k+c++rw++ 
  Sevir.5G041900.1.p  62 RGHWRPAEDAKLKELVAQYGPQNWNLIAEKLD-GRSGKSCRLRWFNQ 107
                         899*****************************.***********996 PP

2Myb_DNA-binding57.43.4e-18114158147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r ++++eE+e+l+ a++ +G++ W++Iar ++ gRt++ +k++w+ +
  Sevir.5G041900.1.p 114 RRAFSEEEEERLLAAHRAYGNK-WALIARLFP-GRTDNAVKNHWHVL 158
                         678*******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.47357108IPR017930Myb domain
SMARTSM007172.3E-1461110IPR001005SANT/Myb domain
SuperFamilySSF466894.69E-2862155IPR009057Homeodomain-like
PfamPF002494.0E-1662107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2663115IPR009057Homeodomain-like
CDDcd001671.22E-1365106No hitNo description
PROSITE profilePS5129427.733109163IPR017930Myb domain
SMARTSM007178.8E-16113161IPR001005SANT/Myb domain
PfamPF002493.6E-15114158IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.7E-21116162IPR009057Homeodomain-like
CDDcd001678.90E-8125159No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MAHEMAAFFG AAPPPAAALA SFRDEQRHRD AADEVYHVDD VEDGDAGHGH GGGGGQGKLC  60
ARGHWRPAED AKLKELVAQY GPQNWNLIAE KLDGRSGKSC RLRWFNQLDP RINRRAFSEE  120
EEERLLAAHR AYGNKWALIA RLFPGRTDNA VKNHWHVLMA RKQREQSGAL RRRKTSSSSS  180
SSPGPAPPQH YAPVVVLHHH HYAGSPPLPF HAAATATAAG AHGVPTEAAA ADTRAYSGGE  240
SDESASTCTT DLSLGSAPCF YQSAYNPGYD AAPRAAAFAP SARSAFSAPS AARHREARSD  300
DKVALTFFDF LGVGAT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-33621624104C-Myb DNA-Binding Domain
1msf_C2e-33621624104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9648551e-160EU964855.1 Zea mays clone 282116 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457638.11e-149hypothetical protein SORBIDRAFT_03g010960
TrEMBLC5XH761e-149C5XH76_SORBI; Putative uncharacterized protein Sb03g010960
STRINGSb03g010960.11e-149(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.12e-58myb domain protein 105